PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 721aa    MW: 80744.3 Da    PI: 6.6125
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.25.3e-2297152156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe+lF+++++p++++r++L+++lgL  rqVk+WFqNrR++ k
  XP_009611250.1  97 KKKYHRHTAHQIRELEALFKESPHPDEKQRQQLSNQLGLHPRQVKFWFQNRRTQIK 152
                     79999***********************************************9877 PP

2START35.81.9e-12272347469
                     HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCG CS
           START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddk 69 
                     ++a++el k+a+ +ep+W ks     e++n+de++++f+++k+      +s+ea+r++gvv m+l++lv+ ++d++
  XP_009611250.1 272 NQATEELKKMATFGEPLWIKSFetgrEILNYDEYMKEFPTEKSgeerltRSIEASRDTGVVSMDLPRLVQCFMDVM 347
                     67899****************99*****************999******************************997 PP

3START141.48.9e-4534645993206
                     EEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHH CS
           START  93 lmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvk 186
                     +m+aelq+l+p+v  R+++f+Ry++qlga++w+ivdvSvd  +++  ++s++++++lpSg+++++ sn h+kvtwveh +++ +++h+l++ +v+
  XP_009611250.1 346 VMFAELQMLTPVVGtRKVYFLRYCKQLGADQWAIVDVSVDKVEDNI-DASLMKCRKLPSGCILQDQSNAHCKVTWVEHLECQQSTVHSLYHAIVN 439
                     799*****************************************98.9*********************************************** PP

                     HHHHHHHHHHHHHTXXXXXX CS
           START 187 sglaegaktwvatlqrqcek 206
                     sg+a+ga++w+atlq+qce+
  XP_009611250.1 440 SGQAFGARHWMATLQQQCER 459
                     ******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-2185155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-2285148IPR009057Homeodomain-like
PROSITE profilePS5007117.89694154IPR001356Homeobox domain
SMARTSM003891.5E-1996158IPR001356Homeobox domain
PfamPF000462.6E-1997152IPR001356Homeobox domain
CDDcd000863.42E-1897152No hitNo description
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PROSITE profilePS5084824.236260462IPR002913START domain
SuperFamilySSF559616.87E-26262460No hitNo description
CDDcd088758.38E-84264458No hitNo description
SMARTSM002341.8E-38269459IPR002913START domain
PfamPF018521.1E-35346459IPR002913START domain
SuperFamilySSF559611.37E-11491713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MKFVDMSNNT PSNSHAKDFA SPALTLSLAG IFRDGAAGNE ETEEVDDGSA GGGRREETTM  60
VEISSENSVP LMSTLSRSRD DFDAENEDYD DPTNSKKKKY HRHTAHQIRE LEALFKESPH  120
PDEKQRQQLS NQLGLHPRQV KFWFQNRRTQ IKAIQERHEN SLLKTEIDKL REVNKALRMA  180
MKKNIPSCPS CGFSSSSKEA AVVIPTQEQQ LRIENARPKT EVEKLRAELG KYTKGTSPTT  240
TSEGNDEENK NGLELQTNTF GLEKSRIMDI VNQATEELKK MATFGEPLWI KSFETGREIL  300
NYDEYMKEFP TEKSGEERLT RSIEASRDTG VVSMDLPRLV QCFMDVMFAE LQMLTPVVGT  360
RKVYFLRYCK QLGADQWAIV DVSVDKVEDN IDASLMKCRK LPSGCILQDQ SNAHCKVTWV  420
EHLECQQSTV HSLYHAIVNS GQAFGARHWM ATLQQQCERL TFFKATSVRI KDSTGPDVAT  480
LAGRKSILKL AQRMTWSFCH AIGASSYNKW DKIHSKTGDD IRVASRKNLT DPREPFGLIL  540
CATSSVWLPF SRNVLFDFLR DETRQHECNI MSNGGPVESI ANLATGQDRG NAVTIQAMKL  600
KEDMWILQDT CTNAYESTVV YAPIDIGGMK SVMTGRDSSN VAVLPSGFSI LPDGLESRSL  660
VITSRPEEKC TGGGSLLTVL YQILTSNSPA VKLSKESVES VNNLISCTLH RIKTSLQCED  720
G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611250.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2 isoform X3
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A0V0IS600.0A0A0V0IS60_SOLCH; Putative homeobox-leucine zipper protein GLABRA 2-like
STRINGPGSC0003DMT4000067700.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein